PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.047510.1
Common NameCsa_6G522650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 262aa    MW: 28613.6 Da    PI: 6.1514
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.047510.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.94.2e-33116172258
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                     +Dgy+WrKYGqK vk+s +prsYYrCt+++C vkk+vers edp++v++tYeg+Hnh
  Cucsa.047510.1 116 EDGYRWRKYGQKAVKNSAYPRSYYRCTTQKCGVKKRVERSYEDPSIVITTYEGQHNH 172
                     8******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-34100174IPR003657WRKY domain
SuperFamilySSF1182903.4E-29107175IPR003657WRKY domain
PROSITE profilePS5081130.813110175IPR003657WRKY domain
SMARTSM007744.8E-38115174IPR003657WRKY domain
PfamPF031064.1E-26116172IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MSDEMFKDLF YSGMDEYESI VRAFGITSDY SNINNEISGT TAMNSSCSLS SSDAGGGEED  60
DSVKEKEKQI SKDVVEDNGG ESSKAAGSGK SKKKGEKKER EARVAFMTKS EVDHLEDGYR  120
WRKYGQKAVK NSAYPRSYYR CTTQKCGVKK RVERSYEDPS IVITTYEGQH NHLIPATLRG  180
NLSAASGTFS PSMLTPMPVV GGVGFLPAEL LSNAGNNQAV GGGATVYSHN NFDYTYNGRQ  240
PEYGLLQDIF PAPSSFFNRQ P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-30106176878Probable WRKY transcription factor 4
2lex_A4e-30106176878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00168DAPTransfer from AT1G29860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9840320.0GU984032.1 Cucumis sativus WRKY protein (WRKY46) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001292668.10.0probable WRKY transcription factor 71
SwissprotQ93WV41e-58WRK71_ARATH; Probable WRKY transcription factor 71
TrEMBLA0A0A0KNS10.0A0A0A0KNS1_CUCSA; Uncharacterized protein
STRINGPOPTR_0011s02790.13e-62(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22313483
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.12e-51WRKY DNA-binding protein 71
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]